Structure of PDB 2per Chain A

Receptor sequence
>2perA (length=222) Species: 9606 (Homo sapiens) [Search protein sequence]
DPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMNPPFLV
YNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYI
KNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFL
DGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREE
FTHTCPEDKEIENTYANVAKQK
3D structure
PDB2per The crystal structure of human chloride intracellular channel protein 2: A disulfide bond with functional implications.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MNB A F110 C114 S185 L186 K189 F86 C90 S161 L162 K165
Gene Ontology
Molecular Function
GO:0004364 glutathione transferase activity
GO:0004602 glutathione peroxidase activity
GO:0005254 chloride channel activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
Biological Process
GO:0006821 chloride transport
GO:0007165 signal transduction
GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0010881 regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
GO:0034220 monoatomic ion transmembrane transport
GO:0051099 positive regulation of binding
GO:0060315 negative regulation of ryanodine-sensitive calcium-release channel activity
GO:0098869 cellular oxidant detoxification
GO:1902476 chloride transmembrane transport
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0034707 chloride channel complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2per, PDBe:2per, PDBj:2per
PDBsum2per
PubMed18186468
UniProtO15247|CLIC2_HUMAN Chloride intracellular channel protein 2 (Gene Name=CLIC2)

[Back to BioLiP]