Structure of PDB 2p6y Chain A |
>2p6yA (length=131) Species: 666 (Vibrio cholerae) [Search protein sequence] |
MIHLIALRLTRGMDLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADS VSTLQVSAPFEILSLSGTLTYQHCHLHIAVADAQGRVWGGHLLEGNLINT AELMIHHYPQHHFTREFDPNTGYSELVVSAA |
|
PDB | 2p6y X-ray structure of the protein Q9KM02_VIBCH from Vibrio cholerae at the resolution 1.63 A. |
Chain | A |
Resolution | 1.63 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H75 H77 H91 |
H75 H77 H91 |
|
|
|
|