Structure of PDB 2p4t Chain A |
>2p4tA (length=58) Species: 562 (Escherichia coli) [Search protein sequence] |
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVHIYP VAALERIN |
|
PDB | 2p4t Structure of the Q67H mutant of R67 dihydrofolate reductase-NADP+ complex reveals a novel cofactor binding mode. |
Chain | A |
Resolution | 1.15 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
K32 H67 I68 Y69 |
Catalytic site (residue number reindexed from 1) |
K12 H47 I48 Y49 |
Enzyme Commision number |
1.5.1.3: dihydrofolate reductase. |
|
|
|
|