Structure of PDB 2p2t Chain A

Receptor sequence
>2p2tA (length=87) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
DRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNP
TWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG
3D structure
PDB2p2t Structure and dynamics of LC8 complexes with KXTQT-motif peptides: swallow and dynein intermediate chain compete for a common site.
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide A R60 F62 G63 S64 Y65 V66 T67 H68 F73 Y75 Y77 R58 F60 G61 S62 Y63 V64 T65 H66 F71 Y73 Y75
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0045505 dynein intermediate chain binding
GO:0051959 dynein light intermediate chain binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0007017 microtubule-based process
GO:0007283 spermatogenesis
GO:0007290 spermatid nucleus elongation
GO:0007291 sperm individualization
GO:0007476 imaginal disc-derived wing morphogenesis
GO:0008407 chaeta morphogenesis
GO:0022416 chaeta development
GO:0034454 microtubule anchoring at centrosome
GO:0035220 wing disc development
GO:0045892 negative regulation of DNA-templated transcription
GO:0048477 oogenesis
GO:0051017 actin filament bundle assembly
GO:0141006 piRNA-mediated retrotransposon silencing by heterochromatin formation
GO:1904801 positive regulation of neuron remodeling
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005814 centriole
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex
GO:0032991 protein-containing complex
GO:0090571 RNA polymerase II transcription repressor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2p2t, PDBe:2p2t, PDBj:2p2t
PDBsum2p2t
PubMed17570393
UniProtQ24117|DYL1_DROME Dynein light chain 1, cytoplasmic (Gene Name=ctp)

[Back to BioLiP]