Structure of PDB 2p0b Chain A

Receptor sequence

>2p0bA (length=142) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

NPDAACLDCHKPDTEGMHGKHASVINPNNKLPVTCTNCHGQPSPQHREGV
KDVMRFNEPMYKVGEQNSVCMSCHLPEQLQKAFWPHDVHVTKVACASCHS
LHPQQDTMQTLSDKGRIKICVDCHSDQRTNPNFNPASVPLLK

3D structure

PDB

2p0b The crystal structure of the pentahaem c-type cytochrome NrfB and characterization of its solution-state interaction with the pentahaem nitrite reductase NrfA.

Chain

Resolution

1.74 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	C24 C27 H28 H57 P60 H64 R65 G67 V71 R73 E76	C6 C9 H10 H39 P42 H46 R47 G49 V53 R55 E58
BS02	HEC	A	H28 E33 M35 H39 C53 C56 H57 F74 S118 L119 H120	H10 E15 M17 H21 C35 C38 H39 F56 S100 L101 H102
BS03	HEC	A	K38 H39 V42 N44 N55 C88 C91 H92 H117 L119 Q127	K20 H21 V24 N26 N37 C70 C73 H74 H99 L101 Q109
BS04	HEC	A	M89 H92 L97 A100 F101 H104 C113 C116 H117 M126	M71 H74 L79 A82 F83 H86 C95 C98 H99 M108
BS05	HEC	A	P103 V106 H107 V111 S115 C138 C141 H142 Q145	P85 V88 H89 V93 S97 C120 C123 H124 Q127

Gene Ontology

	Molecular Function
GO:0020037	heme binding

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:2p0b, PDBe:2p0b, PDBj:2p0b
PDBsum	2p0b
PubMed	17521287
UniProt	P0ABL1\|NRFB_ECOLI Cytochrome c-type protein NrfB (Gene Name=nrfB)

[Back to BioLiP]