Structure of PDB 2ozo Chain A

Receptor sequence
>2ozoA (length=545) Species: 9606 (Homo sapiens) [Search protein sequence]
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLV
HDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKP
CNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEK
LIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALS
LIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLK
EACPNMDTSVFESPFSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQ
GVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGV
CQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEE
KNFVHRNLAARNVLLVNRHYAKISDFGLSKALGPLKWYAPECINFRKFSS
RSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPEL
YALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSALEVA
3D structure
PDB2ozo Structural Basis for the Inhibition of Tyrosine Kinase Activity of ZAP-70.
ChainA
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N461 A463 R465 N466 D479
Catalytic site (residue number reindexed from 1) N407 A409 R411 N412 D425
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A N466 D479 N412 D425
BS02 ANP A L344 G347 N348 V352 A367 K369 M416 A417 P421 R465 N466 L468 D479 L290 G293 N294 V298 A313 K315 M362 A363 P367 R411 N412 L414 D425
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0004672 protein kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0004715 non-membrane spanning protein tyrosine kinase activity
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0005524 ATP binding
Biological Process
GO:0002250 adaptive immune response
GO:0002684 positive regulation of immune system process
GO:0006468 protein phosphorylation
GO:0006955 immune response
GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway
GO:0016310 phosphorylation
GO:0018108 peptidyl-tyrosine phosphorylation
GO:0019722 calcium-mediated signaling
GO:0030154 cell differentiation
GO:0030217 T cell differentiation
GO:0035556 intracellular signal transduction
GO:0042110 T cell activation
GO:0042113 B cell activation
GO:0043366 beta selection
GO:0045059 positive thymic T cell selection
GO:0045060 negative thymic T cell selection
GO:0045061 thymic T cell selection
GO:0045087 innate immune response
GO:0045582 positive regulation of T cell differentiation
GO:0046632 alpha-beta T cell differentiation
GO:0046638 positive regulation of alpha-beta T cell differentiation
GO:0046641 positive regulation of alpha-beta T cell proliferation
GO:0050776 regulation of immune response
GO:0050850 positive regulation of calcium-mediated signaling
GO:0050852 T cell receptor signaling pathway
GO:0070489 T cell aggregation
GO:0072678 T cell migration
Cellular Component
GO:0001772 immunological synapse
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0016020 membrane
GO:0031234 extrinsic component of cytoplasmic side of plasma membrane
GO:0042101 T cell receptor complex
GO:0045121 membrane raft

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ozo, PDBe:2ozo, PDBj:2ozo
PDBsum2ozo
PubMed17512407
UniProtP43403|ZAP70_HUMAN Tyrosine-protein kinase ZAP-70 (Gene Name=ZAP70)

[Back to BioLiP]