Structure of PDB 2ozb Chain A

Receptor sequence

>2ozbA (length=126) Species: 9606 (Homo sapiens)

EADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISE
FIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIAC
SVTIKEGSQLKQQIQSIQQSIERLLV

3D structure

• PDB: 2ozb Binding of the human Prp31 Nop domain to a composite RNA-protein platform in U4 snRNP.
• Chain: A
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	R36 K37 G38 A39 N40 E41 K44 R48 A60 E61 K86 V95 R97 V99 I100	R34 K35 G36 A37 N38 E39 K42 R46 A58 E59 K84 V93 R95 V97 I98

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030515 snoRNA binding
• GO:0030621 U4 snRNA binding
• GO:0030622 U4atac snRNA binding
• GO:0034511 U3 snoRNA binding
• GO:0034512 box C/D sno(s)RNA binding
• GO:0051117 ATPase binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000492 box C/D snoRNP assembly
• GO:0006397 mRNA processing
• GO:0007338 single fertilization
• GO:0008380 RNA splicing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0001651 dense fibrillar component
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005690 U4atac snRNP
• GO:0005730 nucleolus
• GO:0031428 box C/D methylation guide snoRNP complex
• GO:0032040 small-subunit processome
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2ozb, PDBe:2ozb, PDBj:2ozb
• PDBsum: 2ozb
• PubMed: 17412961
• UniProt: P55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)