Structure of PDB 2oz6 Chain A

Receptor sequence
>2oz6A (length=201) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
MKLKHLDKLLAHCHRRRYTAKSTIIYAGDRCETLFFIIKGSVTILIEDDD
GREMIIGYLNSGDFFGELGLFEQERSAWVRAKVECEVAEISYAKFRELSQ
QDSEILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAM
THPDGMQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFG
T
3D structure
PDB2oz6 Crystal Structure of the Pseudomonas aeruginosa Virulence Factor Regulator.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CMP A R59 E60 Q175 G178 R179 G182 C183 S184 R185 R52 E53 Q163 G166 R167 G170 C171 S172 R173 Manual survey: Kd=1.0uM (21665969)
PDBbind-CN: -logKd/Ki=5.26,Kd=5.5uM
BS02 CMP A I51 I63 F72 G73 E74 L75 R87 S88 A89 V91 R128 T132 I44 I56 F65 G66 E67 L68 R75 S76 A77 V79 R116 T120 Manual survey: Kd=1.0uM (21665969)
PDBbind-CN: -logKd/Ki=5.26,Kd=5.5uM
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0030552 cAMP binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2oz6, PDBe:2oz6, PDBj:2oz6
PDBsum2oz6
PubMed21665969
UniProtP55222|VFR_PSEAE cAMP-activated global transcriptional regulator Vfr (Gene Name=vfr)

[Back to BioLiP]