Structure of PDB 2oz1 Chain A

Receptor sequence

>2oz1A (length=261) Species: 35806 (Rhodovulum sulfidophilum)

GPDDPLVINGEIEIVTRAPTPAHLADRFDEIRSGWTFRTDDTQALEMDDF
ENSGMVFVEEARAVWDRPEGTEGKACADCHGAVDDGMYGLRAVYPKYVES
AGKVRTVEQMINACRTSRMGAPEWDYIGPDMTAMVALIASVSRGMPVSVA
IDGPAQSTWEKGREIYYTRYGQLDLSCASCHEQYFDHYIRADHLSQGQIN
GFPSYRLKNARLNAVHDRFRGCIRDTRGVPFAVGSPEFVALELYVASRGN
GLSVEGPSVRN

3D structure

• PDB: 2oz1 The crystal structure of recombinant Rhodovulum sulfidophilum SoxAX confirms cysteine persulfide coordination to the catalytic heme
• Chain: A
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 2.8.5.2: L-cysteine S-thiosulfotransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	K74 C76 C79 H80 M87 L90 Y94 S100 M110 I111 C114 R118 M119	K74 C76 C79 H80 M87 L90 Y94 S100 M110 I111 C114 R118 M119
BS02	HEC	A	R38 L175 C177 C180 H181 H193 L194 S195 G197 Q198 F202 R218 F219 C222 R260	R38 L175 C177 C180 H181 H193 L194 S195 G197 Q198 F202 R218 F219 C222 R260

Gene Ontology

Molecular Function

• GO:0004792 thiosulfate sulfurtransferase activity
• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0016669 oxidoreductase activity, acting on a sulfur group of donors, cytochrome as acceptor
• GO:0016740 transferase activity
• GO:0016783 sulfurtransferase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0019417 sulfur oxidation
• GO:0019418 sulfide oxidation

Cellular Component

• GO:0042597 periplasmic space
• GO:0070069 cytochrome complex

External links

• PDB: RCSB:2oz1, PDBe:2oz1, PDBj:2oz1
• PDBsum: 2oz1
• UniProt: Q939U1|SOXA_RHOSU L-cysteine S-thiosulfotransferase subunit SoxA (Gene Name=soxA)