Structure of PDB 2oy3 Chain A |
>2oy3A (length=98) Species: 10090 (Mus musculus) [Search protein sequence] |
QRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRAL SSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS |
|
PDB | 2oy3 Crystal structure of the cysteine-rich domain of scavenger receptor MARCO reveals the presence of a basic and an acidic cluster that both contribute to ligand recognition. |
Chain | A |
Resolution | 1.78 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D449 D451 D454 V485 |
D29 D31 D34 V65 |
|
|
|
|