Structure of PDB 2ov2 Chain A

Receptor sequence
>2ov2A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence]
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP
VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE
VRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIG
SVKYLECSALTQRGLKTVFDEAIRAVLG
3D structure
PDB2ov2 The crystal structure of the human RAC3 in complex with the CRIB domain of human p21-activated kinase 4 (PAK4)
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 MG A T17 T35 T17 T35
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019901 protein kinase binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0007015 actin filament organization
GO:0007163 establishment or maintenance of cell polarity
GO:0007264 small GTPase-mediated signal transduction
GO:0008045 motor neuron axon guidance
GO:0008360 regulation of cell shape
GO:0014041 regulation of neuron maturation
GO:0016055 Wnt signaling pathway
GO:0016601 Rac protein signal transduction
GO:0021894 cerebral cortex GABAergic interneuron development
GO:0022604 regulation of cell morphogenesis
GO:0030031 cell projection assembly
GO:0030036 actin cytoskeleton organization
GO:0030865 cortical cytoskeleton organization
GO:0031175 neuron projection development
GO:0032956 regulation of actin cytoskeleton organization
GO:0033630 positive regulation of cell adhesion mediated by integrin
GO:0035556 intracellular signal transduction
GO:0043652 engulfment of apoptotic cell
GO:0045730 respiratory burst
GO:0048873 homeostasis of number of cells within a tissue
GO:0050885 neuromuscular process controlling balance
GO:0050905 neuromuscular process
GO:0051932 synaptic transmission, GABAergic
GO:0060326 cell chemotaxis
GO:0098974 postsynaptic actin cytoskeleton organization
GO:0150052 regulation of postsynapse assembly
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1902622 regulation of neutrophil migration
Cellular Component
GO:0005737 cytoplasm
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0030027 lamellipodium
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0031941 filamentous actin
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043020 NADPH oxidase complex
GO:0043025 neuronal cell body
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0071944 cell periphery
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2ov2, PDBe:2ov2, PDBj:2ov2
PDBsum2ov2
PubMed
UniProtP60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 (Gene Name=RAC3)

[Back to BioLiP]