Structure of PDB 2ost Chain A

Receptor sequence

>2ostA (length=148) Species: 1148 (Synechocystis sp. PCC 6803)

MGSTKLKGDIAQQAAIMRALKMGWGVLKPLGDRLSYDLVFDVEGILLKVQ
VKSSWKSEKTGNYVVDNRRTRTNRRNIVRSPYRGNDFDFAVAYVEELELF
YVFPVDVFISYGSEIHLVETDKRQRKPRSFGYREAWHLILQKGAAQKE

3D structure

• PDB: 2ost The restriction fold turns to the dark side: a bacterial homing endonuclease with a PD-(D/E)-XK motif.
• Chain: A
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	T3 K6 G7 D31 D36 S52 W54 T69 R70 N72 R73 R74 E113 Q123 R124	T4 K7 G8 D32 D37 S53 W55 T70 R71 N73 R74 R75 E114 Q124 R125
BS02	dna	A	K4 N61 R67 T71 N72 I76 R78 G111 S112 E113 H115 V117 R122 Q123 R124 R127	K5 N62 R68 T72 N73 I77 R79 G112 S113 E114 H116 V118 R123 Q124 R125 R128
BS03	CA	A	D36 Q49 V50	D37 Q50 V51

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:2ost, PDBe:2ost, PDBj:2ost
• PDBsum: 2ost
• PubMed: 17410205
• UniProt: Q57253