Structure of PDB 2orw Chain A

Receptor sequence
>2orwA (length=171) Species: 2336 (Thermotoga maritima) [Search protein sequence]
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKHSTMIVSGVEA
HVIERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAG
LDLTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEE
IDVGGQEKYIAVCRDCYNTLK
3D structure
PDB2orw Binding of ATP to TK1-like Enzymes Is Associated with a Conformational Change in the Quaternary Structure.
ChainA
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.1.21: thymidine kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C140 C143 C173 C176 C130 C133 C163 C166
BS02 4TA A M12 Y13 G15 K16 T17 T18 E84 F87 L111 T114 H115 A138 V139 T151 E160 D162 V163 G164 Y169 M11 Y12 G14 K15 T16 T17 E74 F77 L101 T104 H105 A128 V129 T141 E150 D152 V153 G154 Y159
Gene Ontology
Molecular Function
GO:0004797 thymidine kinase activity
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016301 kinase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0009157 deoxyribonucleoside monophosphate biosynthetic process
GO:0016310 phosphorylation
GO:0046104 thymidine metabolic process
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2orw, PDBe:2orw, PDBj:2orw
PDBsum2orw
PubMed17407781
UniProtQ9WYN2|KITH_THEMA Thymidine kinase (Gene Name=tdk)

[Back to BioLiP]