Structure of PDB 2orv Chain A

Receptor sequence
>2orvA (length=163) Species: 9606 (Homo sapiens) [Search protein sequence]
RGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYMEALPA
CLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTF
QRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGA
DKYHSVCRLCYFK
3D structure
PDB2orv Binding of ATP to TK1-like Enzymes Is Associated with a Conformational Change in the Quaternary Structure.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.1.21: thymidine kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C153 C156 C188 C125 C128 C160
BS02 4TA A M28 F29 S30 G31 K32 S33 D58 R60 D97 E98 Q100 F101 L124 T127 F128 F133 V172 E173 V174 I175 G176 Y181 M11 F12 S13 G14 K15 S16 D41 R43 D69 E70 Q72 F73 L96 T99 F100 F105 V144 E145 V146 I147 G148 Y153 MOAD: Kd=29nM
Gene Ontology
Molecular Function
GO:0004797 thymidine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016301 kinase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0009157 deoxyribonucleoside monophosphate biosynthetic process
GO:0016310 phosphorylation
GO:0046104 thymidine metabolic process
GO:0046105 thymidine biosynthetic process
GO:0051289 protein homotetramerization
GO:0071897 DNA biosynthetic process
GO:1904860 DNA synthesis involved in mitotic DNA replication
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2orv, PDBe:2orv, PDBj:2orv
PDBsum2orv
PubMed17407781
UniProtP04183|KITH_HUMAN Thymidine kinase, cytosolic (Gene Name=TK1)

[Back to BioLiP]