Structure of PDB 2oq2 Chain A

Receptor sequence

>2oq2A (length=251) Species: 4932 (Saccharomyces cerevisiae)

MKTYHLNNDIIVTQEQLDHWNEQLIKLETPQEIIAWSIVTFPHLFQTTAF
GLTGLVTIDMLSKLSEKYYMPELLFIDTLHHFPQTLTLKNEIEKKYYQPK
NQTIHVYKPDGCESEADFASKYGDFLWEKDDDKYDYLAKVEPAHRAYKEL
HISAVFTGRRKSQGSARSQLSIIEIDELNGILKINPLINWTFEQVKQYID
ANNVPYNELLDLGYRSIGDYHSTQPVKEGEDERAGRWTECGIHEASRFAQ
F

3D structure

• PDB: 2oq2 Crystal structure of Saccharomyces cerevisiae 3'-phosphoadenosine-5'-phosphosulfate reductase complexed with adenosine 3',5'-bisphosphate.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): L210 Y214
• Catalytic site (residue number reindexed from 1): L210 Y214
• Enzyme Commision number: 1.8.4.8: phosphoadenylyl-sulfate reductase (thioredoxin).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	A3P	A	T47 T48 A49 G51 G54 I76 K139 T157 G158 R167 R236 I247 H248	T47 T48 A49 G51 G54 I76 K139 T157 G158 R167 R236 I242 H243

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004604 phosphoadenylyl-sulfate reductase (thioredoxin) activity
• GO:0016491 oxidoreductase activity
• GO:0016667 oxidoreductase activity, acting on a sulfur group of donors
• GO:0098624 3'-phosphoadenylylselenate reductase activity

Biological Process

• GO:0000103 sulfate assimilation
• GO:0006750 glutathione biosynthetic process
• GO:0009086 methionine biosynthetic process
• GO:0019344 cysteine biosynthetic process
• GO:0019379 sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
• GO:0070814 hydrogen sulfide biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2oq2, PDBe:2oq2, PDBj:2oq2
• PDBsum: 2oq2
• PubMed: 18991405
• UniProt: P18408|MET16_YEAST Phosphoadenosine phosphosulfate reductase (Gene Name=MET16)