Structure of PDB 2oo7 Chain A

Receptor sequence
>2oo7A (length=215) Species: 1423 (Bacillus subtilis) [Search protein sequence]
MNLVLMGLPGAGKGTQGERIVEDYGIPHISTGDMFRAAMKEETPLGLEAK
SYIDKGELVPDEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEIL
EEYGKPIDYVINIEVDKDVLMERLTGRRICSVCGTTYHLVFNPPKTPGIC
DKDGGELYQRADDNEETVSKRLEVNMKQIQPLLDFYSEKGYLANVNGQRD
IQDVYADVKDLLGGL
3D structure
PDB2oo7 Crystal structure of a thermostable mutant of Bacillus subtilis Adenylate Kinase (T179I/Q199R)
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K13 R88 R127 R160 R171
Catalytic site (residue number reindexed from 1) K13 R88 R127 R160 R171
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN A C130 C133 C150 D153 C130 C133 C150 D153
BS02 AP5 A P9 G10 G12 K13 G14 T15 T31 G32 R36 I53 E57 V59 G85 R88 Q92 R123 R127 T136 Y137 H138 F141 R160 R171 I201 P9 G10 G12 K13 G14 T15 T31 G32 R36 I53 E57 V59 G85 R88 Q92 R123 R127 T136 Y137 H138 F141 R160 R171 I201
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
GO:0046872 metal ion binding
GO:0050145 nucleoside monophosphate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0009123 nucleoside monophosphate metabolic process
GO:0009132 nucleoside diphosphate metabolic process
GO:0009165 nucleotide biosynthetic process
GO:0016310 phosphorylation
GO:0044209 AMP salvage
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2oo7, PDBe:2oo7, PDBj:2oo7
PDBsum2oo7
PubMed
UniProtP16304|KAD_BACSU Adenylate kinase (Gene Name=adk)

[Back to BioLiP]