Structure of PDB 2ohj Chain A

Receptor sequence

>2ohjA (length=403) Species: 145262 (Methanothermobacter thermautotrophicus)

MKAAAKRISDGVYWTGVLDWDLRNYHGYTLQGTTYNAYLVCGDEGVALID
NSYPGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRRFP
EAPIYCTEVAVKGLLKHYPSLREAEFMTVKTGDVLDLGGKTLTFLETPLL
HWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFYA
NLITPLSKLVLKKFDEVKELGLLERIQMIAPSHGQIWTDPMKIIEAYTGW
ATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVRVYCLHEDDRSE
IVKDILESGAIALGAPTIYDEPYPSVGDLLMYLRGLKFNRTLTRKALVFG
SMGGNGGATGTMKELLAEAGFDVACEEEVYYVPTGDELDACFEAGRKLAA
EIR

3D structure

• PDB: 2ohj Structure of coenzyme F420H2 oxidase (FprA), a di-iron flavoprotein from methanogenic Archaea catalyzing the reduction of O2 to H2O.
• Chain: A
• Resolution: 2.26 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H26 H83 E85 D87 H151 D170 F198 H233
• Catalytic site (residue number reindexed from 1): H26 H83 E85 D87 H151 D170 F198 H233
• Enzyme Commision number: 1.5.3.22: coenzyme F420H2 oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	A	H88 D170 H233	H88 D170 H233
BS02	FE	A	H26 E85 D87	H26 E85 D87
BS03	FMN	A	T265 M266 H267 S269 T270 P316 T317 I318 Y319 S351 M352 G353 G354 G356 Y381	T265 M266 H267 S269 T270 P316 T317 I318 Y319 S351 M352 G353 G354 G356 Y381
BS04	FMN	A	H26 H151	H26 H151

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:2ohj, PDBe:2ohj, PDBj:2ohj
• PDBsum: 2ohj
• PubMed: 17480207
• UniProt: Q50497|FPRA_METTM Coenzyme F420H(2) oxidase (Gene Name=fprA)