Structure of PDB 2odi Chain A

Receptor sequence

>2odiA (length=238) Species: 54910 (Brevibacillus centrosporus) [Search protein sequence]

MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENN
ITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPSS
RNPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNL
SKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMD
LCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL

3D structure

PDB

2odi Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA.

Chain

Resolution

1.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	D33 G34 V36 G37 Q38 N49 D55 K62 G63 R65 R67 S71 T74 H77 K78 K79 R216 H219 R221	D33 G34 V36 G37 Q38 N49 D55 K62 G63 R65 R67 S71 T74 H77 K78 K79 R216 H219 R221
BS02	dna	A	R30 D32 Y95 K97 S100 R101 K109 F111 T113 K115 R118 N120 N121 C202 H214 R216	R30 D32 Y95 K97 S100 R101 K109 F111 T113 K115 R118 N120 N121 C202 H214 R216
BS03	CA	A	D55 E60 L61	D55 E60 L61
BS04	CA	A	N49 D55	N49 D55

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:2odi, PDBe:2odi, PDBj:2odi
PDBsum	2odi
PubMed	17445830
UniProt	Q8RNV8

[Back to BioLiP]