Structure of PDB 2odd Chain A

Receptor sequence
>2oddA (length=50) Species: 9606 (Homo sapiens) [Search protein sequence]
DSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQ
3D structure
PDB2odd Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A S671 E672 T673 C674 S675 G676 Q688 H689 W692 E693 S14 E15 T16 C17 S18 G19 Q31 H32 W35 E36
BS02 ZN A C663 C666 C683 C687 C6 C9 C26 C30
BS03 ZN A C674 C677 H695 C699 C17 C20 H38 C42
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
Biological Process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2odd, PDBe:2odd, PDBj:2odd
PDBsum2odd
PubMed17560331
UniProtQ06455|MTG8_HUMAN Protein CBFA2T1 (Gene Name=RUNX1T1)

[Back to BioLiP]