Structure of PDB 2od2 Chain A

Receptor sequence

>2od2A (length=291) Species: 4932 (Saccharomyces cerevisiae)

MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSP
GTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFH
YLLKLFQDKDVLKRVYTQNFDTLERQAGVKDDLIIEAHGSFAHCHCIGCG
KVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWL
NDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETV
GDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA

3D structure

• PDB: 2od2 Structural basis for nicotinamide inhibition and base exchange in sir2 enzymes.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P42 D43 F44 R45 N116 D118 H135
• Catalytic site (residue number reindexed from 1): P45 D46 F47 R48 N119 D121 H138
• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	E64 V182 F184 G185 E186 D187 P189 S193 A227 V228 Y229	E67 V185 F187 G188 E189 D190 P192 S196 A225 V226 Y227
BS02	ZN	A	C143 C146 C170 C173	C146 C149 C173 C176
BS03	CNA	A	G32 G34 T37 R45 N116 F117 D118 G223 T224 S225 N248 L249 Y269 S270	G35 G37 T40 R48 N119 F120 D121 G221 T222 S223 N246 L247 Y267 S268

Gene Ontology

Molecular Function

• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:2od2, PDBe:2od2, PDBj:2od2
• PDBsum: 2od2
• PubMed: 17289592
• UniProt: P53686|HST2_YEAST NAD-dependent protein deacetylase HST2 (Gene Name=HST2)