Structure of PDB 2o5a Chain A

Receptor sequence

>2o5aA (length=108) Species: 86665 (Halalkalibacterium halodurans)

SNQELLQLAVNAVDDKKAEQVVALNMKGISLDFFLICHGNSEKQVQAIAH
ELKKVAQEQGIEIKRLEGYEQARWVLIDLGDVVVHVFHKDERAYYNLEKL
WPTVELEG

3D structure

• PDB: 2o5a Crystal structure of Q9KD89 from Bacillus halodurans. Northeast Structural Genomics target BhR21
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D35 D84	D32 D81

Gene Ontology

Molecular Function

• GO:0043023 ribosomal large subunit binding

Biological Process

• GO:0006417 regulation of translation
• GO:0017148 negative regulation of translation
• GO:0042256 cytosolic ribosome assembly
• GO:0090071 negative regulation of ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2o5a, PDBe:2o5a, PDBj:2o5a
• PDBsum: 2o5a
• UniProt: Q9KD89|IOJAP_HALH5 Ribosomal silencing factor RsfS (Gene Name=rsfS)