Structure of PDB 2o4p Chain A |
>2o4pA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGI GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 2o4p Unique thermodynamic response of tipranavir to human immunodeficiency virus type 1 protease drug resistance mutations. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|