Structure of PDB 2o35 Chain A |
>2o35A (length=79) Species: 382 (Sinorhizobium meliloti) [Search protein sequence] |
SEISPEQRTAFEAAVFRRLLEHLRERSDVQNIDLMNLAGFCRNCLSNWYR EAAEASGVPMSKEESREIVYGMPYEEWRT |
|
PDB | 2o35 The Crystal Structure of Protein of Unknown Function (DUF1244) from Sinorhizobium meliloti |
Chain | A |
Resolution | 2.12 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
M36 C42 C45 |
M35 C41 C44 |
|
|
|
|