Structure of PDB 2o23 Chain A

Receptor sequence
>2o23A (length=248) Species: 9606 (Homo sapiens) [Search protein sequence]
RSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLG
NNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKK
GQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTAS
VAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPN
FLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQPGS
3D structure
PDB2o23 The structure of wild-type human HADH2 (17beta-hydroxysteroid dehydrogenase type 10) bound to NAD+ at 1.2 A
ChainA
Resolution1.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G21 N121 T153 S155 Y168 K172 F201
Catalytic site (residue number reindexed from 1) G16 N116 T148 S150 Y163 K167 F196
Enzyme Commision number 1.1.1.159: 7alpha-hydroxysteroid dehydrogenase.
1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
1.1.1.239: 3alpha-(17beta)-hydroxysteroid dehydrogenase (NAD(+)).
1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
1.1.1.53: 3alpha(or 20beta)-hydroxysteroid dehydrogenase.
1.1.1.62: 17beta-estradiol 17-dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD A G17 S20 G21 L22 D41 L42 D64 V65 C91 A92 T153 Y168 K172 P198 F201 T203 G12 S15 G16 L17 D36 L37 D59 V60 C86 A87 T148 Y163 K167 P193 F196 T198
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003857 3-hydroxyacyl-CoA dehydrogenase activity
GO:0004303 estradiol 17-beta-dehydrogenase [NAD(P)+] activity
GO:0005515 protein binding
GO:0008709 cholate 7-alpha-dehydrogenase activity
GO:0016491 oxidoreductase activity
GO:0030283 testosterone dehydrogenase [NAD(P)+] activity
GO:0044594 17-beta-hydroxysteroid dehydrogenase (NAD+) activity
GO:0047015 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity
GO:0047035 testosterone dehydrogenase (NAD+) activity
GO:0047044 androstan-3-alpha,17-beta-diol dehydrogenase activity
GO:0106281 chenodeoxycholate 7-alpha-dehydrogenase (NAD+) activity
GO:0106282 isoursodeoxycholate 7-beta-dehydrogenase (NAD+) activity
GO:0106283 ursodeoxycholate 7-beta-dehydrogenase (NAD+) activity
Biological Process
GO:0006550 isoleucine catabolic process
GO:0006629 lipid metabolic process
GO:0006631 fatty acid metabolic process
GO:0006635 fatty acid beta-oxidation
GO:0006699 bile acid biosynthetic process
GO:0007005 mitochondrion organization
GO:0008033 tRNA processing
GO:0008202 steroid metabolic process
GO:0008207 C21-steroid hormone metabolic process
GO:0008209 androgen metabolic process
GO:0008210 estrogen metabolic process
GO:0051289 protein homotetramerization
GO:0062173 brexanolone metabolic process
GO:0070901 mitochondrial tRNA methylation
GO:0097745 mitochondrial tRNA 5'-end processing
GO:1990180 mitochondrial tRNA 3'-end processing
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005886 plasma membrane
GO:0030678 mitochondrial ribonuclease P complex
GO:0042645 mitochondrial nucleoid
GO:0043527 tRNA methyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2o23, PDBe:2o23, PDBj:2o23
PDBsum2o23
PubMed
UniProtQ99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 (Gene Name=HSD17B10)

[Back to BioLiP]