Structure of PDB 2nxq Chain A

Receptor sequence

>2nxqA (length=66) Species: 294381 (Entamoeba histolytica HM-1:IMSS)

AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNG
EIDQNEFAKFYGSIQG

3D structure

• PDB: 2nxq Crystal structure of calcium binding protein-1 from Entamoeba histolytica: A novel arrangement of EF hand motifs.
• Chain: A
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D10 N12 D14 A16 E21	D9 N11 D13 A15 E20
BS02	CA	A	D46 D48 N50 E52 E57	D45 D47 N49 E51 E56

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0003785 actin monomer binding
• GO:0005509 calcium ion binding
• GO:0046872 metal ion binding
• GO:0051015 actin filament binding

Biological Process

• GO:0006909 phagocytosis
• GO:0032231 regulation of actin filament bundle assembly
• GO:0045859 regulation of protein kinase activity
• GO:0050766 positive regulation of phagocytosis
• GO:1905303 positive regulation of macropinocytosis

Cellular Component

• GO:0001891 phagocytic cup
• GO:0005737 cytoplasm
• GO:0031143 pseudopodium
• GO:0042995 cell projection

External links

• PDB: RCSB:2nxq, PDBe:2nxq, PDBj:2nxq
• PDBsum: 2nxq
• PubMed: 17554780
• UniProt: P38505|CABP1_ENTH1 Calcium-binding protein 1 (Gene Name=CaBP1)