Structure of PDB 2nxp Chain A |
>2nxpA (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] |
QPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLF VHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGN ETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFD |
|
PDB | 2nxp Structural analysis and dimerization potential of the human TAF5 subunit of TFIID. |
Chain | A |
Resolution | 2.17 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
Y274 D277 D278 |
Y80 D83 D84 |
|
|
|