Structure of PDB 2nwg Chain A

Receptor sequence
>2nwgA (length=68) Species: 9606 (Homo sapiens) [Search protein sequence]
MKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQV
CIDPKLKWIQEYLEKALN
3D structure
PDB2nwg Structural and Functional Basis of CXCL12 (Stromal Cell-derived Factor-1{alpha}) Binding to Heparin
ChainA
Resolution2.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SGN A K27 R41 K28 R42
BS02 UAP A K27 Q48 K28 Q49
BS03 SGN A R20 A21 R21 A22
BS04 UAP A R20 A21 R21 A22
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005125 cytokine activity
GO:0005178 integrin binding
GO:0005515 protein binding
GO:0008009 chemokine activity
GO:0008083 growth factor activity
GO:0042379 chemokine receptor binding
GO:0045236 CXCR chemokine receptor binding
Biological Process
GO:0001666 response to hypoxia
GO:0001764 neuron migration
GO:0001938 positive regulation of endothelial cell proliferation
GO:0006874 intracellular calcium ion homeostasis
GO:0006935 chemotaxis
GO:0006952 defense response
GO:0006955 immune response
GO:0007155 cell adhesion
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007411 axon guidance
GO:0008015 blood circulation
GO:0008064 regulation of actin polymerization or depolymerization
GO:0008284 positive regulation of cell population proliferation
GO:0008344 adult locomotory behavior
GO:0009612 response to mechanical stimulus
GO:0009615 response to virus
GO:0022029 telencephalon cell migration
GO:0030335 positive regulation of cell migration
GO:0031100 animal organ regeneration
GO:0033603 positive regulation of dopamine secretion
GO:0033622 integrin activation
GO:0038146 chemokine (C-X-C motif) ligand 12 signaling pathway
GO:0038160 CXCL12-activated CXCR4 signaling pathway
GO:0043434 response to peptide hormone
GO:0045666 positive regulation of neuron differentiation
GO:0045785 positive regulation of cell adhesion
GO:0048842 positive regulation of axon extension involved in axon guidance
GO:0050930 induction of positive chemotaxis
GO:0050965 detection of temperature stimulus involved in sensory perception of pain
GO:0050966 detection of mechanical stimulus involved in sensory perception of pain
GO:0051924 regulation of calcium ion transport
GO:0060326 cell chemotaxis
GO:0070098 chemokine-mediated signaling pathway
GO:0090026 positive regulation of monocyte chemotaxis
GO:0090280 positive regulation of calcium ion import
GO:1902230 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:1903237 negative regulation of leukocyte tethering or rolling
GO:1904018 positive regulation of vasculature development
GO:1990478 response to ultrasound
GO:1990869 cellular response to chemokine
GO:2000406 positive regulation of T cell migration
GO:2000669 negative regulation of dendritic cell apoptotic process
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0009897 external side of plasma membrane
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2nwg, PDBe:2nwg, PDBj:2nwg
PDBsum2nwg
PubMed17264079
UniProtP48061|SDF1_HUMAN Stromal cell-derived factor 1 (Gene Name=CXCL12)

[Back to BioLiP]