Structure of PDB 2ns8 Chain A

Receptor sequence

>2ns8A (length=200) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL
DALAIEMLDRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHRDGAKVHLG
TRPTEKQYETLENQLAFLTQQGFSLENALYALSAVGHFTLGSVLEDQEHQ
VAKEERETPTTDSMPPLLRQAIELFDHQGAEPAFLHGLESLIRGFEVQLT

3D structure

PDB

2ns8 How an agonist peptide mimics the antibiotic tetracycline to induce Tet-repressor

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	R104 P105 L113 L117 L134 S135 H139	R102 P103 L111 L115 L132 S133 H137
BS02	peptide	A	E147 D148 H151 Q152 K155 E156 T160 P161 I174 F177 G181 A182	E145 D146 H149 Q150 K153 E154 T158 P159 I172 F175 G179 A180
BS03	peptide	A	L25 T26 T27 R28 Q38 Y42 V45 K46 N47 K48	L23 T24 T25 R26 Q36 Y40 V43 K44 N45 K46

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription
GO:0046677	response to antibiotic

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2ns8, PDBe:2ns8, PDBj:2ns8
PDBsum	2ns8
PubMed	17374541
UniProt	P04483\|TETR2_ECOLX Tetracycline repressor protein class B from transposon Tn10 (Gene Name=tetR)

[Back to BioLiP]