Structure of PDB 2nrm Chain A

Receptor sequence

>2nrmA (length=146) Species: 48168 (Thunnus atlanticus)

ADFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGIAQADI
AGNAAVSAHGATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFK
LISEVLVKVMQEKAGLDAGGQTALRNVMGIIIADLEANYKELGFSG

3D structure

• PDB: 2nrm S-nitrosylation-induced conformational change in blackfin tuna myoglobin.
• Chain: A
• Resolution: 1.09 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.-
  1.7.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	L39 F40 K42 H60 L85 S88 H89 H93 I95 N99 F100	L38 F39 K41 H59 L84 S87 H88 H92 I94 N98 F99

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0016491 oxidoreductase activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0098809 nitrite reductase activity

Biological Process

• GO:0015671 oxygen transport
• GO:0019430 removal of superoxide radicals

Cellular Component

• GO:0005737 cytoplasm
• GO:0016528 sarcoplasm
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:2nrm, PDBe:2nrm, PDBj:2nrm
• PDBsum: 2nrm
• PubMed: 17488722
• UniProt: P68189|MYG_THUTH Myoglobin (Gene Name=mb)