Structure of PDB 2nr0 Chain A

Receptor sequence

>2nr0A (length=264) Species: 83333 (Escherichia coli K-12)

PPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCA
GRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDD
FHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLL
GENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRN
IVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRY
DLPKPPMGPLFLAD

3D structure

• PDB: 2nr0 How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.
• Chain: A
• Resolution: 3.9 Å

Enzymatic activity

• Enzyme Commision number: 5.4.99.12: tRNA pseudouridine(38-40) synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	Q27 Q29 N30 Y140 V167 Q168 A238 T239	Q21 Q23 N24 Y134 V161 Q162 A232 T233	PDBbind-CN: Kd=1.05uM
BS02	rna	A	V46 R78 A82 G86 A89	V40 R72 A76 G80 A83	PDBbind-CN: Kd=1.05uM
BS03	rna	A	R110 F111 E158 S171 T173 R176 N197	R104 F105 E152 S165 T167 R170 N191	PDBbind-CN: Kd=1.05uM

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0009982 pseudouridine synthase activity
• GO:0016853 isomerase activity
• GO:0042803 protein homodimerization activity
• GO:0106029 tRNA pseudouridine synthase activity
• GO:0140098 catalytic activity, acting on RNA
• GO:0160147 tRNA pseudouridine(38-40) synthase activity

Biological Process

• GO:0001522 pseudouridine synthesis
• GO:0006396 RNA processing
• GO:0008033 tRNA processing
• GO:0009451 RNA modification
• GO:0031119 tRNA pseudouridine synthesis

External links

• PDB: RCSB:2nr0, PDBe:2nr0, PDBj:2nr0
• PDBsum: 2nr0
• PubMed: 17466622
• UniProt: P07649|TRUA_ECOLI tRNA pseudouridine synthase A (Gene Name=truA)