Structure of PDB 2nqb Chain A

Receptor sequence
>2nqbA (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB2nqb Comparative analysis of nucleosome structures from different species.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R440 R442 T445 R463 R472 R483 F484 Q485 R516 V517 T518 R3 R5 T8 R26 R35 R46 F47 Q48 R79 V80 T81
BS02 dna A R440 Y441 P443 G444 V446 R449 R463 K464 L465 P466 R469 R483 R3 Y4 P6 G7 V9 R12 R26 K27 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2nqb, PDBe:2nqb, PDBj:2nqb
PDBsum2nqb
PubMed
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]