Structure of PDB 2np6 Chain A

Receptor sequence

>2np6A (length=394) Species: 271 (Thermus aquaticus)

RVETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTAYRFVG
VEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVGEASKYPI
HVFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVPATWL
VLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWD
TQESESGFTPILWAEYPHWEGEIIRFETEETRKLEISGMPLGDLFHIRFA
ARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERA
KELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPS
SLVQWLNSEAMQKHVRTLYRDFVPHLTLRMLERLPVRREYGFHT

3D structure

• PDB: 2np6 Differential binding of s-adenosylmethionine, s-adenosylhomocysteine and sinefungin to the adenine-specific DNA methyltransferase M.Taqi
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y108 K139 T167 L171 E172 D173 K199 K200 F268 R271 R323 H335 P393 H394	Y89 K120 T148 L152 E153 D154 K180 K181 F249 R252 R304 H316 P374 H375
BS02	dna	A	G112 E113 K116 Y117 K126 K130 R271 S272 G295 R296 T336 K337 R353 E354 P393	G93 E94 K97 Y98 K107 K111 R252 S253 G276 R277 T317 K318 R334 E335 P374
BS03	NEA	A	R20 V21 A47 E71 I72 D89 F90 N105 P107	R1 V2 A28 E52 I53 D70 F71 N86 P88

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0008168 methyltransferase activity
• GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity

Biological Process

• GO:0006304 DNA modification
• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:2np6, PDBe:2np6, PDBj:2np6
• PDBsum: 2np6
• UniProt: P14385|MTTA_THEAQ Type II methyltransferase M.TaqI (Gene Name=taqIM)