Structure of PDB 2np2 Chain A

Receptor sequence
>2np2A (length=102) Species: 139 (Borreliella burgdorferi) [Search protein sequence]
RPKVTKSDIVDQIALNIKNNNLKLEKKYIRLVIDAFFEELKSNLCSNNVI
EFRSFGTFEVRKRKGRLNARNPQTGEYVKVLDHHVAYFRPGKDLKERVWG
IK
3D structure
PDB2np2 Shaping the Borrelia burgdorferi genome: crystal structure and binding properties of the DNA-bending protein Hbb.
ChainA
Resolution3.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A E56 F57 R58 R68 K69 R71 N73 R75 P77 Q78 Y92 E51 F52 R53 R63 K64 R66 N68 R70 P72 Q73 Y87 PDBbind-CN: Kd=55nM
BS02 dna A T10 K11 R58 S59 R75 N76 P77 Q78 R94 K97 T5 K6 R53 S54 R70 N71 P72 Q73 R89 K92 PDBbind-CN: Kd=55nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2np2, PDBe:2np2, PDBj:2np2
PDBsum2np2
PubMed17244195
UniProtQ57267|DBH_BORBU DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]