Structure of PDB 2noz Chain A

Receptor sequence
>2nozA (length=310) Species: 9606 (Homo sapiens) [Search protein sequence]
SEFGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGV
LADQVWTLTQTEEQLHCTVYRSQASRPTPDELEAVRKYFQLDVTLAQLYH
HWGSVDSHFQEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVER
LCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSAS
ARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDK
PQAVPVDVHMWHIAQRDYSWHPTTAKGPCPQTNKELGNFFRSLWGPYAGW
AFAVLFSADL
3D structure
PDB2noz Structural characterization of human 8-oxoguanine DNA glycosylase variants bearing active site mutations.
ChainA
Resolution2.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A N149 R154 G202 Y203 R204 N138 R143 G191 Y192 R193
BS02 dna A G42 Q43 F144 S148 N149 N150 N151 I152 G245 G247 T248 K249 V250 M257 D268 H270 F319 G34 Q35 F133 S137 N138 N139 N140 I141 G234 G236 T237 K238 V239 M246 D257 H259 F306
BS03 CA A C241 L243 V246 C230 L232 V235
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0004519 endonuclease activity
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016829 lyase activity
GO:0019104 DNA N-glycosylase activity
GO:0019899 enzyme binding
GO:0032357 oxidized purine DNA binding
GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0140097 catalytic activity, acting on DNA
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006285 base-excision repair, AP site formation
GO:0006289 nucleotide-excision repair
GO:0006355 regulation of DNA-templated transcription
GO:0006974 DNA damage response
GO:0006979 response to oxidative stress
GO:0009314 response to radiation
GO:0009410 response to xenobiotic stimulus
GO:0009416 response to light stimulus
GO:0032355 response to estradiol
GO:0034614 cellular response to reactive oxygen species
GO:0043066 negative regulation of apoptotic process
GO:0044029 positive regulation of gene expression via chromosomal CpG island demethylation
GO:0045007 depurination
GO:0045008 depyrimidination
GO:0045471 response to ethanol
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051593 response to folic acid
GO:0071276 cellular response to cadmium ion
GO:1901291 negative regulation of double-strand break repair via single-strand annealing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol
GO:0016363 nuclear matrix
GO:0016607 nuclear speck
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2noz, PDBe:2noz, PDBj:2noz
PDBsum2noz
PubMed17114185
UniProtO15527|OGG1_HUMAN N-glycosylase/DNA lyase (Gene Name=OGG1)

[Back to BioLiP]