Structure of PDB 2n5h Chain A |
>2n5hA (length=90) Species: 220664 (Pseudomonas protegens Pf-5) [Search protein sequence] |
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMV YIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE |
|
PDB | 2n5h Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PNS |
A |
S42 I65 T66 G67 |
S42 I65 T66 G67 |
|
|
|
|