Structure of PDB 2mxf Chain A

Receptor sequence
>2mxfA (length=47) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
ARKVKQYKNPHTGEVIETKGGNHKTLKEWKAKWGPEAVESWATLLGH
3D structure
PDB2mxf A Novel AT-Rich DNA Recognition Mechanism for Bacterial Xenogeneic Silencer MvaT.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R80 T96 K97 N100 H101 K102 R2 T18 K19 N22 H23 K24 PDBbind-CN: Kd=10.7uM
BS02 dna A A79 R80 K81 K83 Y85 G98 G99 N100 K105 K108 A1 R2 K3 K5 Y7 G20 G21 N22 K27 K30 PDBbind-CN: Kd=10.7uM
External links