Structure of PDB 2mpm Chain A

Receptor sequence
>2mpmA (length=74) Species: 9606 (Homo sapiens) [Search protein sequence]
GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC
ADPKKKWVQDSMKYLDQKSPTPKP
3D structure
PDB2mpm Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A A14 N15 R16 K17 I18 R22 L45 K47 I49 K55 A14 N15 R16 K17 I18 R22 L45 K47 I49 K55
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0008009 chemokine activity
GO:0031728 CCR3 chemokine receptor binding
GO:0046983 protein dimerization activity
GO:0048018 receptor ligand activity
GO:0048020 CCR chemokine receptor binding
Biological Process
GO:0001938 positive regulation of endothelial cell proliferation
GO:0002544 chronic inflammatory response
GO:0002551 mast cell chemotaxis
GO:0006468 protein phosphorylation
GO:0006874 intracellular calcium ion homeostasis
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007010 cytoskeleton organization
GO:0007015 actin filament organization
GO:0007155 cell adhesion
GO:0007165 signal transduction
GO:0007611 learning or memory
GO:0008360 regulation of cell shape
GO:0009314 response to radiation
GO:0009615 response to virus
GO:0030335 positive regulation of cell migration
GO:0030838 positive regulation of actin filament polymerization
GO:0035962 response to interleukin-13
GO:0043547 positive regulation of GTPase activity
GO:0045766 positive regulation of angiogenesis
GO:0048245 eosinophil chemotaxis
GO:0050768 negative regulation of neurogenesis
GO:0060444 branching involved in mammary gland duct morphogenesis
GO:0060763 mammary duct terminal end bud growth
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0070098 chemokine-mediated signaling pathway
GO:0070371 ERK1 and ERK2 cascade
GO:0070670 response to interleukin-4
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mpm, PDBe:2mpm, PDBj:2mpm
PDBsum2mpm
PubMed25450766
UniProtP51671|CCL11_HUMAN Eotaxin (Gene Name=CCL11)

[Back to BioLiP]