Structure of PDB 2ml3 Chain A

Receptor sequence

>2ml3A (length=181) Species: 354 (Azotobacter vinelandii)

ADPGVEGTPVVGSDLDDELHGTLGSEQILGGGGADQLYGYAGNDLLDGGA
GRDKLSGGEGADTFRFALREDSHRSPLGTFGDRILDFDPSQDRIDVSALG
FSGLGNGYAGSLAVSVSDDGTRTYLKSYEADAQGLSFEVALEGDHAAALS
ADNIVFAATDAAAAGELGVIGASGQPDDPTV

3D structure

• PDB: 2ml3 Structural and Functional Characterization of the R-modules in Alginate C-5 Epimerases AlgE4 and AlgE6 from Azotobacter vinelandii
• Chain: A
• Resolution: N/A

Enzymatic activity

• Enzyme Commision number: 5.1.3.37: mannuronan 5-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	G12 S13 L15 D17 G30 G32 D35	G12 S13 L15 D17 G30 G32 D35
BS02	CA	A	T22 G24 E26 G39 A41 D44	T22 G24 E26 G39 A41 D44
BS03	CA	A	G31 G32 G33 D35 G48 G49 A50 D53	G31 G32 G33 D35 G48 G49 A50 D53
BS04	CA	A	Y40 G42 D44 G57 G58 E59 D62	Y40 G42 D44 G57 G58 E59 D62
BS05	CA	A	G48 G49 G51 D53 D71 D82	G48 G49 G51 D53 D71 D82
BS06	CA	A	G58 G60 D62 D92	G58 G60 D62 D92

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding

Cellular Component

• GO:0005615 extracellular space

External links

• PDB: RCSB:2ml3, PDBe:2ml3, PDBj:2ml3
• PDBsum: 2ml3
• PubMed: 25266718
• UniProt: Q9ZFH0|ALGE6_AZOVI Mannuronan C5-epimerase AlgE6 (Gene Name=algE6)