Structure of PDB 2ml1 Chain A

Receptor sequence

>2ml1A (length=153) Species: 354 (Azotobacter vinelandii) [Search protein sequence]

AQGTDGNDVLIGSDVGEQISGGAGDDRLDGGAGDDLLDGGAGRDRLTGGL
GADTFRFALREDSHRSPLGTFSDLILDFDPSQDKIDVSALGFIGLGNGYA
GTLAVSLSADGLRTYLKSYDADAQGRSFELALDGNHAATLSAGNIVFAAA
TPG

3D structure

PDB

2ml1 Structural and Functional Characterization of the R-modules in Alginate C-5 Epimerases AlgE4 and AlgE6 from Azotobacter vinelandii

Chain

Resolution

N/A

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

5.1.3.37: mannuronan 5-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	T4 G6 D8 G21 A23 D26	T4 G6 D8 G21 A23 D26
BS02	CA	A	S13 V15 E17 G30 A32 D35	S13 V15 E17 G30 A32 D35
BS03	CA	A	G22 A23 G24 D26 G39 G40 A41 D44	G22 A23 G24 D26 G39 G40 A41 D44
BS04	CA	A	G31 A32 G33 D35 G48 G49 L50 D53	G31 A32 G33 D35 G48 G49 L50 D53
BS05	CA	A	G40 G42 D44 D62 D73	G40 G42 D44 D62 D73
BS06	CA	A	G49 G51 D53 D79 D83	G49 G51 D53 D79 D83

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding

	Cellular Component
GO:0005615	extracellular space

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:2ml1, PDBe:2ml1, PDBj:2ml1
PDBsum	2ml1
PubMed	25266718
UniProt	Q9ZFH0\|ALGE6_AZOVI Mannuronan C5-epimerase AlgE6 (Gene Name=algE6)

[Back to BioLiP]