Structure of PDB 2mhm Chain A

Receptor sequence

>2mhmA (length=108) Species: 559292 (Saccharomyces cerevisiae S288C)

TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEG
YSYTDANIKKNVLWDENNMSEHLTNPAKYIPGTKMAFGGLKKEKDRNDLI
TYLKKATE

3D structure

• PDB: 2mhm Structural Basis for Cytochrome c Y67H Mutant to Function as a Peroxidase
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C14 C17 H18 P30 I35 S40 Y48 T49 W59 T78 K79 M80	C19 C22 H23 P35 I40 S45 Y53 T54 W64 T83 K84 M85

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:2mhm, PDBe:2mhm, PDBj:2mhm
• PDBsum: 2mhm
• PubMed: 25210769
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)