Structure of PDB 2mgy Chain A

Receptor sequence
>2mgyA (length=169) Species: 10090 (Mus musculus) [Search protein sequence]
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLA
PIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFF
GARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVL
NYYVWRDNSGRRGGSRLAE
3D structure
PDB2mgy Structure of the mitochondrial translocator protein in complex with a diagnostic ligand.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PKA A A23 V26 L49 W95 A110 L114 W143 A147 A23 V26 L49 W95 A110 L114 W143 A147
Gene Ontology
Molecular Function
GO:0005497 androgen binding
GO:0008503 benzodiazepine receptor activity
GO:0044325 transmembrane transporter binding
Biological Process
GO:0006694 steroid biosynthetic process
GO:0006811 monoatomic ion transport
GO:0006821 chloride transport
GO:0006869 lipid transport
GO:0008347 glial cell migration
GO:0009410 response to xenobiotic stimulus
GO:0010042 response to manganese ion
GO:0010266 response to vitamin B1
GO:0014012 peripheral nervous system axon regeneration
GO:0030325 adrenal gland development
GO:0031397 negative regulation of protein ubiquitination
GO:0032570 response to progesterone
GO:0032720 negative regulation of tumor necrosis factor production
GO:0033574 response to testosterone
GO:0042632 cholesterol homeostasis
GO:0043065 positive regulation of apoptotic process
GO:0045019 negative regulation of nitric oxide biosynthetic process
GO:0048265 response to pain
GO:0048266 behavioral response to pain
GO:0048678 response to axon injury
GO:0050810 regulation of steroid biosynthetic process
GO:0051901 positive regulation of mitochondrial depolarization
GO:0051928 positive regulation of calcium ion transport
GO:0060242 contact inhibition
GO:0060252 positive regulation of glial cell proliferation
GO:0060253 negative regulation of glial cell proliferation
GO:0062100 positive regulation of programmed necrotic cell death
GO:0071222 cellular response to lipopolysaccharide
GO:0071294 cellular response to zinc ion
GO:0071476 cellular hypotonic response
GO:0072655 establishment of protein localization to mitochondrion
GO:0072656 maintenance of protein location in mitochondrion
GO:1901525 negative regulation of mitophagy
GO:1903579 negative regulation of ATP metabolic process
GO:1905144 response to acetylcholine
GO:2000379 positive regulation of reactive oxygen species metabolic process
GO:2000853 negative regulation of corticosterone secretion
Cellular Component
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mgy, PDBe:2mgy, PDBj:2mgy
PDBsum2mgy
PubMed24653034
UniProtP50637|TSPO_MOUSE Translocator protein (Gene Name=Tspo)

[Back to BioLiP]