Structure of PDB 2mfg Chain A

Receptor sequence

>2mfgA (length=59) Species: 294 (Pseudomonas fluorescens)

MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD

3D structure

• PDB: 2mfg Molecular basis for the wide range of affinity found in Csr/Rsm protein-RNA recognition.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	M1 L2 I3 L4 T5 K7	M1 L2 I3 L4 T5 K7	PDBbind-CN: Kd=2.9uM
BS02	rna	A	L23 S26 G27 R31 A36 P37 K38 V40 A41 V42 H43	L23 S26 G27 R31 A36 P37 K38 V40 A41 V42 H43	PDBbind-CN: Kd=2.9uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0006109 regulation of carbohydrate metabolic process
• GO:0006402 mRNA catabolic process
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation
• GO:0045948 positive regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2mfg, PDBe:2mfg, PDBj:2mfg
• PDBsum: 2mfg
• PubMed: 24561806
• UniProt: P0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)