Structure of PDB 2mfe Chain A

Receptor sequence

>2mfeA (length=59) Species: 294 (Pseudomonas fluorescens)

MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD

3D structure

• PDB: 2mfe Molecular basis for the wide range of affinity found in Csr/Rsm protein-RNA recognition.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	M1 L2 I3 L4 T5 K7	M1 L2 I3 L4 T5 K7	PDBbind-CN: Kd=0.185uM
BS02	rna	A	L23 G27 Q28 Q29 R31 A36 P37 K38 V42 H43 R44 I47 R50 I51 P58	L23 G27 Q28 Q29 R31 A36 P37 K38 V42 H43 R44 I47 R50 I51 P58	PDBbind-CN: Kd=0.185uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0006109 regulation of carbohydrate metabolic process
• GO:0006402 mRNA catabolic process
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation
• GO:0045948 positive regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2mfe, PDBe:2mfe, PDBj:2mfe
• PDBsum: 2mfe
• PubMed: 24561806
• UniProt: P0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)