Structure of PDB 2mfc Chain A

Receptor sequence

>2mfcA (length=59) Species: 294 (Pseudomonas fluorescens)

MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD

3D structure

• PDB: 2mfc Molecular basis for the wide range of affinity found in Csr/Rsm protein-RNA recognition.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	M1 L2 I3 L4 T5 K7	M1 L2 I3 L4 T5 K7	PDBbind-CN: Kd=1.9uM
BS02	rna	A	L23 G27 Q29 R31 A36 P37 K38 V40 V42 H43 R44 I47 R50 I51	L23 G27 Q29 R31 A36 P37 K38 V40 V42 H43 R44 I47 R50 I51	PDBbind-CN: Kd=1.9uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0006109 regulation of carbohydrate metabolic process
• GO:0006402 mRNA catabolic process
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation
• GO:0045948 positive regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2mfc, PDBe:2mfc, PDBj:2mfc
• PDBsum: 2mfc
• PubMed: 24561806
• UniProt: P0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)