Structure of PDB 2m3l Chain A |
>2m3lA (length=76) Species: 10595 (human papillomavirus 51) [Search protein sequence] |
GSHMSRSVYGTTLEAITKKSLYDLSIRCHRCQRPLGPEEKQKLVDEKKRF HEIAGRWTGQCANCWQRTRQRNETQV |
|
PDB | 2m3l Structural insights into a wildtype domain of the oncoprotein E6 and its interaction with a PDZ domain. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C103 C106 |
C28 C31 |
|
|
|