Structure of PDB 2m30 Chain A |
>2m30A (length=95) Species: 1280 (Staphylococcus aureus) [Search protein sequence] |
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSH QLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE |
|
PDB | 2m30 Solution NMR refinement of a metal ion bound protein using metal ion inclusive restrained molecular dynamics methods. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H97 H100 |
H89 H92 |
|
BS02 |
ZN |
A |
D84 H86 |
D76 H78 |
|
|
|
|