Structure of PDB 2lyb Chain A |
>2lybA (length=131) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] |
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLL ETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEAL DKIEEEQNKSKKKAQQAAADTGNNSQVSQNY |
|
PDB | 2lyb Trio engagement via plasma membrane phospholipids and the myristoyl moiety governs HIV-1 matrix binding to bilayers. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
8SP |
A |
F44 L64 |
F43 L63 |
PDBbind-CN: -logKd/Ki=4.46,Kd=35uM |
|
|
|