Structure of PDB 2lvz Chain A

Receptor sequence

>2lvzA (length=133) Species: 9606 (Homo sapiens)

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFAN
VVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCRYAD
RPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

3D structure

• PDB: 2lvz Insights into the glycosaminoglycan-mediated cytotoxic mechanism of eosinophil cationic protein revealed by NMR.
• Chain: A
• Resolution: N/A

Enzymatic activity

• Catalytic site (original residue number in PDB): K38 H128 L129 D130
• Catalytic site (residue number reindexed from 1): K38 H128 L129 D130
• Enzyme Commision number: 3.1.27.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LVZ	A	R7 R34 H128	R7 R34 H128
BS02	SGN	A	K38 N39	K38 N39

Gene Ontology

Molecular Function

• GO:0001530 lipopolysaccharide binding
• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004540 RNA nuclease activity

Biological Process

• GO:0002227 innate immune response in mucosa
• GO:0006401 RNA catabolic process
• GO:0006935 chemotaxis
• GO:0019731 antibacterial humoral response
• GO:0042742 defense response to bacterium
• GO:0043152 induction of bacterial agglutination
• GO:0045087 innate immune response
• GO:0050829 defense response to Gram-negative bacterium
• GO:0050830 defense response to Gram-positive bacterium
• GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0035578 azurophil granule lumen

External links

• PDB: RCSB:2lvz, PDBe:2lvz, PDBj:2lvz
• PDBsum: 2lvz
• PubMed: 23025322
• UniProt: P12724|ECP_HUMAN Eosinophil cationic protein (Gene Name=RNASE3)