Structure of PDB 2lp2 Chain A

Receptor sequence
>2lp2A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKD
VDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
3D structure
PDB2lp2 Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A S19 E22 G23 D24 K27 E32 S19 E22 G23 D24 K27 E32
BS02 CA A D62 N64 D66 E68 E73 D62 N64 D66 E68 E73
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0051117 ATPase binding
Biological Process
GO:0008016 regulation of heart contraction
GO:0021762 substantia nigra development
GO:0035556 intracellular signal transduction
GO:0051000 positive regulation of nitric-oxide synthase activity
GO:1903672 positive regulation of sprouting angiogenesis
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0016529 sarcoplasmic reticulum
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2lp2, PDBe:2lp2, PDBj:2lp2
PDBsum2lp2
PubMed23351007
UniProtP23297|S10A1_HUMAN Protein S100-A1 (Gene Name=S100A1)

[Back to BioLiP]