Structure of PDB 2lmu Chain A

Receptor sequence

>2lmuA (length=147) Species: 7227 (Drosophila melanogaster)

SELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDL
IAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFIS
PAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK

3D structure

• PDB: 2lmu Structure of androcam supports specialized interactions with myosin VI.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D93 D95 D97 F99 E104	D92 D94 D96 F98 E103
BS02	CA	A	D129 D131 D133 M135 E140	D128 D130 D132 M134 E139

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0030234 enzyme regulator activity
• GO:0046872 metal ion binding
• GO:0070855 myosin VI head/neck binding

Biological Process

• GO:0030048 actin filament-based movement

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0031476 myosin VI complex
• GO:0070865 investment cone

External links

• PDB: RCSB:2lmu, PDBe:2lmu, PDBj:2lmu
• PDBsum: 2lmu
• PubMed: 22851764
• UniProt: P49258|CALL_DROME Calmodulin-related protein 97A (Gene Name=Acam)